PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013281-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 315aa    MW: 34747.4 Da    PI: 8.9891
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013281-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W++ ++  g+ R++k+c++rw +yl
  AHYPO_013281-RA 14 KGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.76.4e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  AHYPO_013281-RA  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.586961IPR017930Myb domain
SuperFamilySSF466899.35E-3013108IPR009057Homeodomain-like
SMARTSM007174.9E-141363IPR001005SANT/Myb domain
PfamPF002494.5E-161461IPR001005SANT/Myb domain
CDDcd001675.84E-121661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2865117IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002494.3E-1767111IPR001005SANT/Myb domain
CDDcd001675.50E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR LHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLISRG  120
LDPQTHRPLN STTVVNAPVG ANVNGKKPPE NLGFNLPVIT QYATVPQTIE FKKSYSDMYS  180
NKVKSESCNS GTTTDDGQMG RVSSRVQISK EDHDIDLELS IGLSKFQGEV RNCTTSSAES  240
GVMDLGSSLN SGLGSFELFN QPINKGGTCM CYDLGFQLKG TTNMNGQGQG NCSKCQGKSG  300
YLPIFSRYIG PLGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680433.11e-146PREDICTED: transcription repressor MYB6-like
SwissprotQ388511e-90MYB6_ARATH; Transcription repressor MYB6
SwissprotP813953e-90MYB30_ANTMA; Myb-related protein 330
TrEMBLA0A0J8D7D41e-146A0A0J8D7D4_BETVU; Uncharacterized protein
STRINGPOPTR_0019s11090.13e-99(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.19e-90myb domain protein 6